Structure of PDB 7ukg Chain A Binding Site BS01

Receptor Information
>7ukg Chain A (length=259) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TARQRVWRAFENPHTSTMALVFYYVTGFFIAVSVIANVVETVPCGSSPGH
IKELPCGERYAVAFFCLDTACVMIFTVEYLLRLAAAPSRYRFVRSVMSII
DVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRIFKFSRHSQGLRILGY
TLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAAFWYTI
VTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQ
NQRADKRRA
Ligand information
>7ukg Chain I (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIAIALLVILVICSLIVTSVILL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ukg Activation and closed-state inactivation mechanisms of the human voltage-gated K V 4 channel complexes.
Resolution2.24 Å
Binding residue
(original residue number in PDB)		V186 F193 F194 A228 C231 A235
Binding residue
(residue number reindexed from 1)		V21 F28 F29 A63 C66 A70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005216 monoatomic ion channel activity
GO:0005249 voltage-gated potassium channel activity
Biological Process
GO:0006811 monoatomic ion transport
GO:0006813 potassium ion transport
GO:0051260 protein homooligomerization
GO:0055085 transmembrane transport
Cellular Component
GO:0008076 voltage-gated potassium channel complex
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ukg, PDBe:7ukg, PDBj:7ukg
PDBsum7ukg
PubMed35597238
UniProtQ9NZV8|KCND2_HUMAN A-type voltage-gated potassium channel KCND2 (Gene Name=KCND2)

[Back to BioLiP]