Structure of PDB 7ui8 Chain A Binding Site BS01

Receptor Information
>7ui8 Chain A (length=113) Species: 1355 (Enterococcus columbae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TNPKEGQLATTVSVKNNESTTPVRLLSKDTQGVEVTDTVSYSDLVGGKVY
ELTGTLMQIKADGSTEAIASASKEVTAETSGKGTWELTFAPQNLKAGEKY
VVYEVAKSKENLV
Ligand information
>7ui8 Chain B (length=23) Species: 1355 (Enterococcus columbae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GDTKHEVRHENPQDEAQTIVVNK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ui8 Intramolecular ester bond-containing repeat domain from E. columbae adhesin (split and religated)
Resolution2.373 Å
Binding residue
(original residue number in PDB)		E10 G11 Q12 L13 T15 T16 V17 T26 P27 V28 R29 L30 S32 D42 Y55 I64 K100 A101 G102 E103 K104 Y105 V106 V107 Y108 E109 V110 A111 K112 S113 N116 V118
Binding residue
(residue number reindexed from 1)		E5 G6 Q7 L8 T10 T11 V12 T21 P22 V23 R24 L25 S27 D37 Y50 I59 K95 A96 G97 E98 K99 Y100 V101 V102 Y103 E104 V105 A106 K107 S108 N111 V113
Enzymatic activity
Enzyme Commision number ?
External links