Structure of PDB 7uhe Chain A Binding Site BS01

Receptor Information
>7uhe Chain A (length=71) Species: 4930 (Saccharomyces) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKGSVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFII
DLYSLPEGLLKSLWDYVKKNT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uhe Taf2 mediates DNA binding of Taf14.
Resolution1.66 Å
Binding residue
(original residue number in PDB)
A181 G216 E217 F218 I219 I220 D221 L222 Y223
Binding residue
(residue number reindexed from 1)
A11 G46 E47 F48 I49 I50 D51 L52 Y53
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7uhe, PDBe:7uhe, PDBj:7uhe
PDBsum7uhe
PubMed35676274
UniProtP35189|TAF14_YEAST Transcription initiation factor TFIID subunit 14 (Gene Name=TAF14)

[Back to BioLiP]