Structure of PDB 7ubl Chain A Binding Site BS01

Receptor Information
>7ubl Chain A (length=141) Species: 2681611 (Escherichia phage Lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDKQKAINYLMQFAHKVSGKYRGVAKLEGNTKAKVLQVLATFAYADYCRS
AATPGARCRDCHGTGRAVDIAKTKLWGRVVEKECGRCKGVGYSRMPASAA
YRAVTMLIPNLTQPTWSRTVKPLYDALVVQCHKEESIADNI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ubl In transcription antitermination by Q lambda , NusA induces refolding of Q lambda to form a nozzle that extends the RNA polymerase RNA-exit channel.
Resolution2.177 Å
Binding residue
(original residue number in PDB)		D120 A127 V128 K142 A157 S158 R162 Q173 S177 R178 K181
Binding residue
(residue number reindexed from 1)		D60 A67 V68 K82 A97 S98 R102 Q113 S117 R118 K121
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7ubl, PDBe:7ubl, PDBj:7ubl
PDBsum7ubl
PubMed35951650
UniProtP03047|REGQ_LAMBD Antitermination protein Q (Gene Name=Q)

[Back to BioLiP]