Structure of PDB 7u5v Chain A Binding Site BS01

Receptor Information
>7u5v Chain A (length=124) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALAAASAAAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKR
EKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINID
GQKHIVIFAMRKIYRGEELTYDYA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7u5v Crystal structure of the Mixed Lineage Leukaemia (MLL1) SET Domain with the cofactor product S-Adenosylhomocysteine and Borealin peptide.
Resolution2.59 Å
Binding residue
(original residue number in PDB)
Y3858 E3872 D3876 C3882 Y3883 M3884 F3885 R3886 R3903 Y3944
Binding residue
(residue number reindexed from 1)
Y37 E51 D55 C61 Y62 M63 F64 R65 R82 Y123
Enzymatic activity
Enzyme Commision number 2.1.1.-
2.1.1.364: [histone H3]-lysine(4) N-methyltransferase.
External links
PDB RCSB:7u5v, PDBe:7u5v, PDBj:7u5v
PDBsum7u5v
PubMed37945831
UniProtQ03164|KMT2A_HUMAN Histone-lysine N-methyltransferase 2A (Gene Name=KMT2A)

[Back to BioLiP]