Structure of PDB 7tzk Chain A Binding Site BS01

Receptor Information
>7tzk Chain A (length=64) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNAQPKKYAKSKYDFVARNNSELSVLKDDILEILDDRKQWWKVRNASGDS
GFVPNNILDIVRPP
Ligand information
>7tzk Chain C (length=12) Species: 574521 (Escherichia coli O127:H6 str. E2348/69) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PPELPSVDYNSL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tzk Targeting of microvillus protein Eps8 by the NleH effector kinases from enteropathogenic E. coli
Resolution1.43 Å
Binding residue
(original residue number in PDB)		Y540 R545 N546 E549 K565 Q566 W567 F579 P581 N583
Binding residue
(residue number reindexed from 1)		Y13 R18 N19 E22 K38 Q39 W40 F52 P54 N56
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7tzk, PDBe:7tzk, PDBj:7tzk
PDBsum7tzk
PubMed35976880
UniProtQ12929|EPS8_HUMAN Epidermal growth factor receptor kinase substrate 8 (Gene Name=EPS8)

[Back to BioLiP]