Structure of PDB 7txj Chain A Binding Site BS01

Receptor Information
>7txj Chain A (length=153) Species: 346882 (Betalipothrixvirus pozzuoliense) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RLSQASVLRYYAKRFTMNVGTTAHVLGKEVAGNPWVAKAIDKLSYQETYN
WISDYQASHLAKQVAKQVAEKYGIPPTFQGLLMAYAEKVVANYILDYKGE
SLTQMHDNYLYELMQKMPSSGYIYVFIGKDGKTHTVDMSKVLTDIEDALL
KRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7txj Cryo-EM of AFV6
Resolution3.9 Å
Binding residue
(original residue number in PDB)
Y16 R20 D60 E93 K94
Binding residue
(residue number reindexed from 1)
Y10 R14 D54 E87 K88
Enzymatic activity
Enzyme Commision number ?
External links