Structure of PDB 7tuq Chain A Binding Site BS01

Receptor Information
>7tuq Chain A (length=124) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVK
LNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNK
PGDDIVLMAEALEKLFLQKINELP
Ligand information
>7tuq Chain C (length=3) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VKN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tuq Binding of the SARS-CoV-2 envelope E protein to human BRD4 is essential for infection.
Resolution2.68 Å
Binding residue
(original residue number in PDB)		L94 Y97 C136 N140
Binding residue
(residue number reindexed from 1)		L53 Y56 C95 N99
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7tuq, PDBe:7tuq, PDBj:7tuq
PDBsum7tuq
PubMed35716662
UniProtO60885|BRD4_HUMAN Bromodomain-containing protein 4 (Gene Name=BRD4)

[Back to BioLiP]