Structure of PDB 7tud Chain A Binding Site BS01

Receptor Information
>7tud Chain A (length=274) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAP
WIEQEGPEYWDRETQISKTNTQCYRENLRTALRYYNQSEAGSHIIQRMYG
CDVGPDGRLLRGYDQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tud Structural mechanism of tapasin-mediated MHC-I peptide loading in antigen presentation.
Resolution1.45 Å
Binding residue
(original residue number in PDB)
Y7 Y9 K45 Y59 R62 E63 I66 N70 C73 Y99 V152 Q155 D156 Y159 L163 S167 R170 Y171
Binding residue
(residue number reindexed from 1)
Y7 Y9 K45 Y59 R62 E63 I66 N70 C73 Y99 V152 Q155 D156 Y159 L163 S167 R170 Y171
Enzymatic activity
Enzyme Commision number ?
External links