Structure of PDB 7tsx Chain A Binding Site BS01

Receptor Information

>7tsx Chain A (length=217) Species: 550 (Enterobacter cloacae)

NANDIRSKKVLIIGAGSLGSMIAENLMRIGVVSQGILDADLLQTGNLSRH
ALTMTSVGHNKAAALVEHLNRILPDASARSFSCAFPPESEVAKNSLRQYD
VIIDCTGDDGVLKSLAAFDWKSEKIFISLAMTWRAEGLFAFAASETSFPV
TDASSRFNASAGAWHPVFPARADDVQLWAAVGTKFICRVVSAPGRIYEYF
KQMPDGTVEKEPHEYGS

Ligand information

>7tsx Chain D (length=5) Species: 550 (Enterobacter cloacae)

TGRFA

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7tsx An E1-E2 fusion protein primes antiviral immune signalling in bacteria.
• Resolution: 1.77 Å
• Binding residue (original residue number in PDB): S388 L389 C476 G478 A501 M502 W504 F510 F528 N529
• Binding residue (residue number reindexed from 1): S17 L18 C105 G107 A130 M131 W133 F139 F157 N158

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 12:07:05 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7tsx', asym_id = 'A', bs = 'BS01', title = 'An E1-E2 fusion protein primes antiviral immune signalling in bacteria.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7tsx', asym_id='A', bs='BS01', title='An E1-E2 fusion protein primes antiviral immune signalling in bacteria.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0008641', uniprot = '', pdbid = '7tsx', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0008641', uniprot='', pdbid='7tsx', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>