Structure of PDB 7trl Chain A Binding Site BS01

Receptor Information
>7trl Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEFISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKC
FCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7trl Molecular basis for nuclear accumulation and targeting of the inhibitor of apoptosis BIRC2.
Resolution1.74 Å
Binding residue
(original residue number in PDB)
G312 L313 R314 C315 W316 W329
Binding residue
(residue number reindexed from 1)
G56 L57 R58 C59 W60 W73
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:7trl, PDBe:7trl, PDBj:7trl
PDBsum7trl
PubMed37524969
UniProtQ13490|BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 (Gene Name=BIRC2)

[Back to BioLiP]