Structure of PDB 7trd Chain A Binding Site BS01

Receptor Information
>7trd Chain A (length=934) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLV
CVPWDARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLTS
VRSYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAY
QVCGPPLYQLPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLV
ETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKT
HCPLRDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFL
RNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLRE
EILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIG
IRQHLKRVQLRELSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDY
VVAERLTSRVKALFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVR
AQDPPPELYFVKVDVTGAYDTIPQDRLTEVIASIIKPQNTYCVRRYAVVQ
KAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHLQETSPLRDAVVIEQSSSL
NEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTLLCSLCYGD
MENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVV
NLRKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSS
YARTSIRASLTFNRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVC
TNIYKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTASLCYSILK
AKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVPLLGSLRT
AQTQLSRKLPGTTLTALEAAANPALPSDFKTILD
Ligand information
>7trd Chain B (length=217) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggccauuuuuugucuaacccuaacugagaagggcguaggcgccgugcuuu
ugcuccccgcgcgcuguuuuucucgcugacuuucagcgggcggaaaagcc
ucggccugccgccuuccgagcaaacaaaaaaugucagcugcuggccgagg
ccgcggucggcccggggcuucuccggaggcacccacugccaccgcgaaga
guugggcucugucagcc
<<<<<.........................<<<<<<<<<<.....<<<<<
<.....<<<<.<<<<<........(((((((((>>>>>.>>>>>>>>>>.
...>>>>>.>>>>>..............))).))))))...>>>>>..<<
<<<<<<<.<<<..<<<<<<<<....>>>>>.>>>...>>>>>>>>>.<<<
<.....>>>>....>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7trd Structure of active human telomerase with telomere shelterin protein TPP1.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		R8 R15 Q53 Y333 K338 Q340 L341 R342 P343 R351 S353 L354 T355 R369 W371 R381 L382 Q384 R385 W387 P404 V407 Y462 R466 R470 R471 R481 R485 R489 K492 W510 K511 S513 V514 R515 C528 V529 P530 A531 H534 R535 E538 R558 R620 I633 N635 Q748 R756 R819 R821 G834 S835 I836 F964 K965 A966 G967 R979 Q1023 Q1024 N1028 G1057 A1058 K1059 S1067 E1068 R1086 T1088
Binding residue
(residue number reindexed from 1)		R2 R9 Q47 Y172 K177 Q179 L180 R181 P182 R190 S192 L193 T194 R208 W210 R220 L221 Q223 R224 W226 P243 V246 Y274 R278 R282 R283 R293 R297 R301 K304 W322 K323 S325 V326 R327 C340 V341 P342 A343 H346 R347 E350 R370 R432 I445 N447 Q550 R558 R621 R623 G636 S637 I638 F766 K767 A768 G769 R781 Q825 Q826 N830 G859 A860 K861 S869 E870 R888 T890
Enzymatic activity
Enzyme Commision number 2.7.7.49: RNA-directed DNA polymerase.
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0001223 transcription coactivator binding
GO:0003677 DNA binding
GO:0003720 telomerase activity
GO:0003723 RNA binding
GO:0003964 RNA-directed DNA polymerase activity
GO:0003968 RNA-dependent RNA polymerase activity
GO:0005515 protein binding
GO:0042162 telomeric DNA binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0051087 protein-folding chaperone binding
GO:0070034 telomerase RNA binding
GO:0098680 template-free RNA nucleotidyltransferase
Biological Process
GO:0000723 telomere maintenance
GO:0001172 RNA-templated transcription
GO:0006278 RNA-templated DNA biosynthetic process
GO:0007004 telomere maintenance via telomerase
GO:0007005 mitochondrion organization
GO:0010629 negative regulation of gene expression
GO:0022616 DNA strand elongation
GO:0030177 positive regulation of Wnt signaling pathway
GO:0030422 siRNA processing
GO:0031647 regulation of protein stability
GO:0032092 positive regulation of protein binding
GO:0042635 positive regulation of hair cycle
GO:0043066 negative regulation of apoptotic process
GO:0043524 negative regulation of neuron apoptotic process
GO:0045766 positive regulation of angiogenesis
GO:0046326 positive regulation of D-glucose import
GO:0046686 response to cadmium ion
GO:0051000 positive regulation of nitric-oxide synthase activity
GO:0070200 establishment of protein localization to telomere
GO:0071456 cellular response to hypoxia
GO:0071897 DNA biosynthetic process
GO:0090399 replicative senescence
GO:0140745 siRNA transcription
GO:1900087 positive regulation of G1/S transition of mitotic cell cycle
GO:1902895 positive regulation of miRNA transcription
GO:1903620 positive regulation of transdifferentiation
GO:1904707 positive regulation of vascular associated smooth muscle cell proliferation
GO:1904751 positive regulation of protein localization to nucleolus
GO:1904754 positive regulation of vascular associated smooth muscle cell migration
GO:2000352 negative regulation of endothelial cell apoptotic process
GO:2000648 positive regulation of stem cell proliferation
GO:2000773 negative regulation of cellular senescence
GO:2001240 negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
Cellular Component
GO:0000333 telomerase catalytic core complex
GO:0000781 chromosome, telomeric region
GO:0000783 nuclear telomere cap complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005697 telomerase holoenzyme complex
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016605 PML body
GO:0016607 nuclear speck
GO:0031379 RNA-directed RNA polymerase complex
GO:0042645 mitochondrial nucleoid
GO:0043231 intracellular membrane-bounded organelle
GO:1990572 TERT-RMRP complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7trd, PDBe:7trd, PDBj:7trd
PDBsum7trd
PubMed35418675
UniProtO14746|TERT_HUMAN Telomerase reverse transcriptase (Gene Name=TERT)

[Back to BioLiP]