Structure of PDB 7to8 Chain A Binding Site BS01

Receptor Information
>7to8 Chain A (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPM
DMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEK
IFLQKVAQMPQEEVEL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7to8 BRD3-BD1 in complex with RaPID linear peptide 2xAcK.1 (diAcK)
Resolution1.5 Å
Binding residue
(original residue number in PDB)
W57 P58 Q61 K67 L68 N69 I122
Binding residue
(residue number reindexed from 1)
W26 P27 Q30 K36 L37 N38 I91
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7to8, PDBe:7to8, PDBj:7to8
PDBsum7to8
PubMed37992806
UniProtQ15059|BRD3_HUMAN Bromodomain-containing protein 3 (Gene Name=BRD3)

[Back to BioLiP]