Structure of PDB 7tdx Chain A Binding Site BS01

Receptor Information
>7tdx Chain A (length=90) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PEFFHNMDYFKYHNMRPPFTYATLIRWAILEAPERQRTLNEIYHWFTRMF
AYFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDEF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tdx The transcription factor FoxP3 can fold into two dimerization states with divergent implications for regulatory T cell function and immune homeostasis.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		L360 R386 H387 S390 R397 W406
Binding residue
(residue number reindexed from 1)		L39 R65 H66 S69 R76 W85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7tdx, PDBe:7tdx, PDBj:7tdx
PDBsum7tdx
PubMed35926508
UniProtQ99JB6|FOXP3_MOUSE Forkhead box protein P3 (Gene Name=Foxp3)

[Back to BioLiP]