Structure of PDB 7tdw Chain A Binding Site BS01

Receptor Information

>7tdw Chain A (length=90) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PEFFHNMDYFKYHNMRPPFTYATLIRWAILEAPERQRTLNEIYHWFTRMF
AYFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDEF

Ligand information

>7tdw Chain B (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaatttgtttactc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7tdw The transcription factor FoxP3 can fold into two dimerization states with divergent implications for regulatory T cell function and immune homeostasis.
Resolution	4.0 Å
Binding residue (original residue number in PDB)	L360 R386 S390 R397 W406
Binding residue (residue number reindexed from 1)	L39 R65 S69 R76 W85

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7tdw, PDBe:7tdw, PDBj:7tdw
PDBsum	7tdw
PubMed	35926508
UniProt	Q99JB6\|FOXP3_MOUSE Forkhead box protein P3 (Gene Name=Foxp3)

[Back to BioLiP]