Structure of PDB 7tcq Chain A Binding Site BS01

Receptor Information
>7tcq Chain A (length=213) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQFQQSGTVLARPGASVKMSCKASGYTFTNYWIHWVKQRPGQGLEYIGG
TYPGNGDTTYNQKFKGKAKVTAVTPTSTAYMDLSSLTNEDSAVYYCTRTG
SYFDYWGQGTTLTVSSASTTAPSVYPLAPVCTGSSVTLGCLVKGYFPEPV
TLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHP
ASSTKVDKKIEPR
Ligand information
>7tcq Chain D (length=11) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FKEELDKYFKu
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tcq Vaccine-elicited murine antibody WS6 neutralizes diverse beta-coronaviruses by recognizing a helical stem supersite of vulnerability.
Resolution2.02 Å
Binding residue
(original residue number in PDB)		N31 Y32 W33 H35 Y47 D56 T58 G96 S97
Binding residue
(residue number reindexed from 1)		N31 Y32 W33 H35 Y47 D57 T59 G100 S101
External links