Structure of PDB 7t1u Chain A Binding Site BS01

Receptor Information
>7t1u Chain A (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APWQAEEWYFGKITRRESERLLLNAENPRGTFLVREGQSQPDYVLSVSDF
DNAKGLNVKHYIIRKLDSGFYITSRTQFNSLQQLVAYYSKHADGLCHRLT
TVCPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7t1u Engineered SH2 Domains for Targeted Phosphoproteomics.
Resolution2.65 Å
Binding residue
(original residue number in PDB)
R158 R178 S182 Q183 K202 H203 Y204 I205 I216 T217 G238
Binding residue
(residue number reindexed from 1)
R15 R35 S39 Q40 K59 H60 Y61 I62 I72 T73 G94
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:7t1u, PDBe:7t1u, PDBj:7t1u
PDBsum7t1u
PubMed35613471
UniProtP12931|SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]