Structure of PDB 7t1k Chain A Binding Site BS01

Receptor Information
>7t1k Chain A (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKPLHEQLWYHGAIPRAEVAELLVHSGDFLVREGQSQPDYVLSVLWDGLP
RHFIIQSLDNLYRLEGEGFPSIPLLIDHLLSTQQPLTKKSGVVLHRAVPK
SR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7t1k Engineered SH2 Domains for Targeted Phosphoproteomics.
Resolution1.25 Å
Binding residue
(original residue number in PDB)		R16 R32 G34 Q35 S36 Q37 R51 H52 F53 I54 Q56 L64
Binding residue
(residue number reindexed from 1)		R16 R32 G34 Q35 S36 Q37 R51 H52 F53 I54 Q56 L64
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:7t1k, PDBe:7t1k, PDBj:7t1k
PDBsum7t1k
PubMed35613471
UniProtP07332|FES_HUMAN Tyrosine-protein kinase Fes/Fps (Gene Name=FES)

[Back to BioLiP]