Structure of PDB 7t0l Chain A Binding Site BS01

Receptor Information
>7t0l Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAP
WIEQEGPEYWDRETQISKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYG
CDVGPDGRLLRGYHQNAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7t0l HLA-B*27:05 in complex with the pan-HLA-Ia monoclonal antibody W6/32
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Y7 H9 T24 E45 R62 E63 I66 S67 K70 T73 D77 Y84 L95 Y99 N116 T143 K146 W147 V152 Q155 Y159 E163 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 H9 T24 E45 R62 E63 I66 S67 K70 T73 D77 Y84 L95 Y99 N116 T143 K146 W147 V152 Q155 Y159 E163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002474 antigen processing and presentation of peptide antigen via MHC class I
Cellular Component
GO:0016020 membrane
GO:0030670 phagocytic vesicle membrane
GO:0042612 MHC class I protein complex
GO:0098553 lumenal side of endoplasmic reticulum membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7t0l, PDBe:7t0l, PDBj:7t0l
PDBsum7t0l
PubMed
UniProtA3F718

[Back to BioLiP]