Structure of PDB 7ssg Chain A Binding Site BS01

Receptor Information
>7ssg Chain A (length=382) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAAKEGFAFKHDREQYQLFCDSFPFETTPDQAQAINAVLSDMCQPLAMDR
LVCGDVGFGKTEVAMRAAFLAVDNHKQVAVLVPTTLLAQQHYDNFRDRFA
NWPVRIEMISRFRSAKEQTQILAEVAEGKIDILIGTHKLLQSDVKFKDLG
LLIVDEEHRFGVRHKERIKAMRANVDILTLTATPIPRTLNMAMSGMRDLS
IIATPPARRLAVKTFVREYDSMVVREAILREILRGGQVYYLYNDVENIQK
AAERLAELVPEARIAIGHGQMRERELERVMNDFHHQRFNVLVCTTIIETG
IDIPTANTIIIERADHFGLAQLHQLRGRVGRSHHQAYAWLLTPHPKAMTT
DAQKRLEAIASLEDLGAGFALATHDLEIRGAG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ssg Mechanism of transcription modulation by the transcription-repair coupling factor.
Resolution5.2 Å
Binding residue
(original residue number in PDB)
R929 D949 L950
Binding residue
(residue number reindexed from 1)
R355 D375 L376
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0015616 DNA translocase activity
GO:0016787 hydrolase activity
GO:0043175 RNA polymerase core enzyme binding
Biological Process
GO:0000716 transcription-coupled nucleotide-excision repair, DNA damage recognition
GO:0006281 DNA repair
GO:0006283 transcription-coupled nucleotide-excision repair
GO:0006294 nucleotide-excision repair, preincision complex assembly
GO:0006355 regulation of DNA-templated transcription
GO:0006974 DNA damage response
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:1990391 DNA repair complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7ssg, PDBe:7ssg, PDBj:7ssg
PDBsum7ssg
PubMed35641110
UniProtP30958|MFD_ECOLI Transcription-repair-coupling factor (Gene Name=mfd)

[Back to BioLiP]