Structure of PDB 7sow Chain A Binding Site BS01

Receptor Information
>7sow Chain A (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHHHHHSQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIA
SFHRVQALTTDISLIFAALKDSKVVEIVDEKVRRREEPEKWPLPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sow Structural basis of 3'-end RNA recognition by LARP1
Resolution1.3 Å
Binding residue
(original residue number in PDB)		Y336 Y337 D346 F348 L349 F367 H368 R369
Binding residue
(residue number reindexed from 1)		Y21 Y22 D31 F33 L34 F52 H53 R54
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7sow, PDBe:7sow, PDBj:7sow
PDBsum7sow
PubMed
UniProtQ6PKG0|LARP1_HUMAN La-related protein 1 (Gene Name=LARP1)

[Back to BioLiP]