Structure of PDB 7sov Chain A Binding Site BS01

Receptor Information
>7sov Chain A (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRVQ
ALTTDISLIFAALKDSKVVEIVDEKVRRREEPEKWPLPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sov Structural basis of 3'-end poly(A) RNA recognition by LARP1.
Resolution1.45 Å
Binding residue
(original residue number in PDB)
Q333 Y336 Y337 D346 F348 S366 F367 H368 R369
Binding residue
(residue number reindexed from 1)
Q12 Y15 Y16 D25 F27 S45 F46 H47 R48
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7sov, PDBe:7sov, PDBj:7sov
PDBsum7sov
PubMed35979957
UniProtQ6PKG0|LARP1_HUMAN La-related protein 1 (Gene Name=LARP1)

[Back to BioLiP]