Structure of PDB 7sos Chain A Binding Site BS01

Receptor Information
>7sos Chain A (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRVQA
LTTDISLIFAALKDSKVVEIVDEKVRRREEPEKWPLPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sos Structural basis of 3'-end poly(A) RNA recognition by LARP1.
Resolution1.25 Å
Binding residue
(original residue number in PDB)
Q333 Y336 Y337 R345 D346 F348 F367 H368 R369
Binding residue
(residue number reindexed from 1)
Q11 Y14 Y15 R23 D24 F26 F45 H46 R47
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7sos, PDBe:7sos, PDBj:7sos
PDBsum7sos
PubMed35979957
UniProtQ6PKG0|LARP1_HUMAN La-related protein 1 (Gene Name=LARP1)

[Back to BioLiP]