Structure of PDB 7soq Chain A Binding Site BS01

Receptor Information
>7soq Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HSQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRV
QALTTDISLIFAALKDSKVVEIVDEKVRRREEPEKWPLPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7soq Structural basis of 3'-end poly(A) RNA recognition by LARP1.
Resolution1.15 Å
Binding residue
(original residue number in PDB)
Q333 Y336 Y337 D346 F348 L349 F367 H368 R369
Binding residue
(residue number reindexed from 1)
Q13 Y16 Y17 D26 F28 L29 F47 H48 R49
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7soq, PDBe:7soq, PDBj:7soq
PDBsum7soq
PubMed35979957
UniProtQ6PKG0|LARP1_HUMAN La-related protein 1 (Gene Name=LARP1)

[Back to BioLiP]