Structure of PDB 7sl5 Chain A Binding Site BS01

Receptor Information
>7sl5 Chain A (length=228) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLVQSGGGVVQPGESLRLSCSGSGFTFNNYIMHWVRQAPGQGLDYVSGI
GSDGRNTNYGDSVKGRFTISRDNSKDTLYLQMTSLRAEDTAFYYCVKGLD
VLRFLDLSTPSGERLDAFDIWGQGTMVTVSSASTKGPSVFPLAPSSSGGT
AALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP
SSSLGTQTYICNVNHKPSNTKVDKRVEP
Ligand information
>7sl5 Chain C (length=14) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PSKRSFIEDLLFNK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sl5 ACE2-binding exposes the SARS-CoV-2 fusion peptide to broadly neutralizing coronavirus antibodies.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		N31 G52 S53 D54 R56 N57 T58 D101 V102 L103
Binding residue
(residue number reindexed from 1)		N30 G51 S52 D53 R55 N56 T57 D100 V101 L102
External links