Structure of PDB 7sih Chain A Binding Site BS01

Receptor Information
>7sih Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAP
WIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYG
CDLGPDGRLLRGHDQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
>7sih Chain C (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NPDIVYQY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sih Molecular insights into the HLA-B35 molecules Px and Py group classification associated with HIV control
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y7 R62 N63 I66 T73 E76 S77 N80 L81 Y84 I95 R97 Y99 F116 T143 K146 W147 V152 Q155 L156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 R62 N63 I66 T73 E76 S77 N80 L81 Y84 I95 R97 Y99 F116 T143 K146 W147 V152 Q155 L156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links