Structure of PDB 7sft Chain A Binding Site BS01

Receptor Information
>7sft Chain A (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISF
EDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSG
Ligand information
>7sft Chain B (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WKVGFFKRNRPPLEEDDEEGE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sft Filamin complex-2
ResolutionN/A
Binding residue
(original residue number in PDB)		G2267 A2268 G2269 G2270 L2271 I2273 A2274 F2285 D2287 K2289 G2291 C2293
Binding residue
(residue number reindexed from 1)		G32 A33 G34 G35 L36 I38 A39 F50 D52 K54 G56 C58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0051015 actin filament binding
Biological Process
GO:0030036 actin cytoskeleton organization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7sft, PDBe:7sft, PDBj:7sft
PDBsum7sft
PubMed36867840
UniProtP21333|FLNA_HUMAN Filamin-A (Gene Name=FLNA)

[Back to BioLiP]