Structure of PDB 7sa3 Chain A Binding Site BS01

Receptor Information
>7sa3 Chain A (length=303) Species: 91464 (Synechococcus sp. PCC 7335) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TWDRFCNWVTSTENRLYIGWFGVLMLPLLGVSITVFVTAFIAAPPVDIDG
IREPLSGSLLYGNNIITAAVVPTSNAIGLHFYPIWEAATLDEWLYNGGPY
QMIAFHYIPALLCYLGREWELSYRLGMRPWICIAYSAPVAATISVFLIYP
IGQGSFSDGLPMGISGTFNFMFVFQAEHNILMHPFHMLGVAGVLGGSLFC
AMHGSLVTSSLVNILAAHGYFGRLIFQFNNSRQLHFFLAAWPVVCIWFVA
LGISTMAFNLNGFNFNHSVLDSQGRVLPSWADVVNRASLGFEVMHERNAH
NFP
Ligand information
>7sa3 Chain I (length=27) Species: 91464 (Synechococcus sp. PCC 7335) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MVTLKIVVYLTVSFFVGLFIFGFLSGD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sa3 Structure of a monomeric photosystem II core complex from a cyanobacterium acclimated to far-red light reveals the functions of chlorophylls d and f.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		W15 W33 F34 L37 P40 I97 W98 Y136
Binding residue
(residue number reindexed from 1)		W2 W20 F21 L24 P27 I84 W85 Y123
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0016168 chlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0009635 response to herbicide
GO:0009772 photosynthetic electron transport in photosystem II
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009523 photosystem II
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7sa3, PDBe:7sa3, PDBj:7sa3
PDBsum7sa3
PubMed34801554
UniProtB4WKH9

[Back to BioLiP]