Structure of PDB 7s7j Chain A Binding Site BS01

Receptor Information
>7s7j Chain A (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EAERVRVFHKQAFEYISIALRIDEDEKAGQKEQAVEWYKKGIEELEKGIA
VIVTGQGEQCERARRLQAKMMTNLVMAKDRLQLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7s7j Comprehensive analysis of the human ESCRT-III-MIT domain interactome reveals new cofactors for cytokinetic abscission.
Resolution1.15 Å
Binding residue
(original residue number in PDB)		H120 A123 F124 L131 E135 Y149 K180 N184 M187 A188 R191
Binding residue
(residue number reindexed from 1)		H9 A12 F13 L20 E24 Y38 K69 N73 M76 A77 R80
Enzymatic activity
Enzyme Commision number 5.6.1.1: microtubule-severing ATPase.
External links
PDB RCSB:7s7j, PDBe:7s7j, PDBj:7s7j
PDBsum7s7j
PubMed36107470
UniProtQ9UBP0|SPAST_HUMAN Spastin (Gene Name=SPAST)

[Back to BioLiP]