Structure of PDB 7s68 Chain A Binding Site BS01

Receptor Information

>7s68 Chain A (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHF
SCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEASKKEKDKDSKLEK
ALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADG
MVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTP
KEFREISYLKKLKVKKQDRIFPP

Ligand information

>7s68 Chain M (length=10) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gcctgcaggc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7s68 Captured snapshots of PARP1 in the active state reveal the mechanics of PARP1 allostery.
Resolution	3.3 Å
Binding residue (original residue number in PDB)	R18 F44 N259
Binding residue (residue number reindexed from 1)	R14 F40 N123

Enzymatic activity

Enzyme Commision number

2.4.2.-
2.4.2.30: NAD(+) ADP-ribosyltransferase.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0008270	zinc ion binding

View graph for
Molecular Function

External links

PDB	RCSB:7s68, PDBe:7s68, PDBj:7s68
PDBsum	7s68
PubMed	35793673
UniProt	P09874\|PARP1_HUMAN Poly [ADP-ribose] polymerase 1 (Gene Name=PARP1)

[Back to BioLiP]