Structure of PDB 7s51 Chain A Binding Site BS01

Receptor Information
>7s51 Chain A (length=161) Species: 1314 (Streptococcus pyogenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AQQLPVIGGIAIPELGINLPIFKGLGNTELIYGAGTMKEEQVMGGENNYS
LASHHIFGITGSSQMLFSPLERAQNGMSIYLTDKEKIYEYIIKDVFTVAP
ERVDVIDDTAGLKEVTLVTATDIEATERIIVKGELKTEYDFDKAPADVLK
AFNHSYNQVST
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7s51 Structures of Streptococcus pyogenes class A sortase in complex with substrate and product mimics provide key details of target recognition.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		S141 H142 H143 P188 E189 T207 A208 R216
Binding residue
(residue number reindexed from 1)		S53 H54 H55 P100 E101 T119 A120 R128
Enzymatic activity
Enzyme Commision number ?
External links