Structure of PDB 7s47 Chain A Binding Site BS01

Receptor Information

>7s47 Chain A (length=290) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAV
KKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLE
GGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRNIKSDSILLT
HDGRVKLSDFGFCAQVSKEVPRRKELVGTPYWMAPELISRLPYGPEVDIW
SLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFL
DRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNR

Ligand information

>7s47 Chain B (length=6) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RARYEM

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7s47 Molecular basis for integrin adhesion receptor binding to p21-activated kinase 4 (PAK4)
Resolution	2.0 Å
Binding residue (original residue number in PDB)	E329 G330 S331 N440 K442 D444 F461 G477 T478 Y480 W481 E507 E512 F516 M524
Binding residue (residue number reindexed from 1)	E30 G31 S32 N141 K143 D145 F162 G178 T179 Y181 W182 E208 E213 F217 M225

Enzymatic activity

Enzyme Commision number

2.7.11.1: non-specific serine/threonine protein kinase.

Gene Ontology

	Molecular Function
GO:0004672	protein kinase activity
GO:0005524	ATP binding

	Biological Process
GO:0006468	protein phosphorylation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7s47, PDBe:7s47, PDBj:7s47
PDBsum	7s47
PubMed
UniProt	O96013\|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 (Gene Name=PAK4); P18084

[Back to BioLiP]