Structure of PDB 7ru6 Chain A Binding Site BS01

Receptor Information
>7ru6 Chain A (length=315) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSTVTRLIYAFILLLSTVVSYIMQRKEMETYLKKIVGYKAVYRISFAMAI
FFFVFSLLMFKVKTSKDLRAAVHNGFWFFKIAALIGIMVGSFYIPGGYFS
SVWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALL
SFTSAFYILSIICVGLLYTYYTKPDGCTENKFFISINLILCVVASIISIH
PKIQEHQPRSGLLQSSLITLYTMYLTWSAMSNEPDRSCNDSDNFIGLFVF
VLCLLYSSIEKEGVQYSYSLFHLMLCLASLYIMMTLTKWPAVWVKISSSW
VCLLLYVWTLVAPLV
Ligand information
>7ru6 Chain L (length=16) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FYSRYSWYGYSYGWSR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ru6 Antiviral HIV-1 SERINC restriction factors disrupt virus membrane asymmetry.
Resolution4.4 Å
Binding residue
(original residue number in PDB)		E195 R200 Y203 Q261 P265 L269
Binding residue
(residue number reindexed from 1)		E138 R143 Y146 Q204 P208 L212
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0015194 L-serine transmembrane transporter activity
Biological Process
GO:0006564 L-serine biosynthetic process
GO:0009597 detection of virus
GO:0015825 L-serine transport
GO:0045087 innate immune response
GO:0051607 defense response to virus
GO:1902237 positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
Cellular Component
GO:0000139 Golgi membrane
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ru6, PDBe:7ru6, PDBj:7ru6
PDBsum7ru6
PubMed37474505
UniProtQ13530|SERC3_HUMAN Serine incorporator 3 (Gene Name=SERINC3)

[Back to BioLiP]