Structure of PDB 7rqr Chain A Binding Site BS01

Receptor Information

>7rqr Chain A (length=215) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PVKLVESGGGVVQPGRSLRLSCEASGFIFSTYGMHWVRQAPGKGLEWVAV
IWFDGSNIYYADSVKGRFTISRDNSKNTVFMQMDSLRAEDTAVYYCHRNF
YDGSGPFDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPE
PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV
NHKPSNTKVDKKVEP

Ligand information

>7rqr Chain C (length=6) Species: 36329 (Plasmodium falciparum 3D7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ANPNVD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7rqr The light chain of the L9 antibody is critical for binding circumsporozoite protein minor repeats and preventing malaria.
Resolution	2.23 Å
Binding residue (original residue number in PDB)	Y32 F96 Y97 D98
Binding residue (residue number reindexed from 1)	Y32 F100 Y101 D102

External links

PDB	RCSB:7rqr, PDBe:7rqr, PDBj:7rqr
PDBsum	7rqr
PubMed	35172158

[Back to BioLiP]