Structure of PDB 7rpu Chain A Binding Site BS01

Receptor Information
>7rpu Chain A (length=210) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLLESGGGLVKPGGSLRLSCAASGFTFNEYMMNWVRQPPGKGLEWVSS
ISGTSTYINYADSVKGRFTISRDNAKNSLYLQMNSLRSDDTAMYYCARGS
TGGYWGQGTLITVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSN
TKVDKKVEPK
Ligand information
>7rpu Chain P (length=13) Species: 129000 (Ebola virus - Eckron (Zaire, 1976)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IHDFVDKTLPDQG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rpu Protection against Ebola virus disease and neutralization mechanism of a survivor's anti-stalk-MPER antibody
Resolution1.27 Å
Binding residue
(original residue number in PDB)		E31 Y32 M33 N59 R98 G99 S100 T101
Binding residue
(residue number reindexed from 1)		E31 Y32 M33 N59 R98 G99 S100 T101
External links