Structure of PDB 7rma Chain A Binding Site BS01

Receptor Information
>7rma Chain A (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMQIFVRTHAMRTDVLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQ
LEDGRTLSDYNIRQESILHLLLWPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rma Panel of Engineered Ubiquitin Variants Targeting the Family of Human Ubiquitin Interacting Motifs.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
I44 F45 A46 G47 I66 H68 L70
Binding residue
(residue number reindexed from 1)
I45 F46 A47 G48 I67 H69 L71
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7rma, PDBe:7rma, PDBj:7rma
PDBsum7rma
PubMed35385646
UniProtP0CG47|UBB_HUMAN Polyubiquitin-B (Gene Name=UBB)

[Back to BioLiP]