Structure of PDB 7rm1 Chain A Binding Site BS01

Receptor Information
>7rm1 Chain A (length=221) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGW
INSNTGEPTYAEEFKGRFAFSLETSASTAYLQINNLKNEDTATYFCARWA
NCGCAMDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY
ICNVNHKPSNTKVDKKVEPKS
Ligand information
>7rm1 Chain P (length=18) Species: 5855 (Plasmodium vivax) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GAGNQPGANGAGNQPGAN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rm1 Structural basis of Plasmodium vivax inhibition by antibodies binding to the circumsporozoite protein repeats.
Resolution3.19 Å
Binding residue
(original residue number in PDB)
N31 Y32 G33 W50 N52 S52A N53 W95 G99
Binding residue
(residue number reindexed from 1)
N31 Y32 G33 W50 N52 S53 N54 W99 G103
External links