Structure of PDB 7rk7 Chain A Binding Site BS01

Receptor Information
>7rk7 Chain A (length=238) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYG
CDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAA
HVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPTHTLRCWLSFYPAEIL
TDQTQLVETRPAGDGTFQKWVPSGEQTCHQHEGPKLTL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rk7 The complex between TIL 1383i TCR and human Class I MHC HLA-A2 with the bound Tyrosinase(369-377)(N371D) nonameric peptide
Resolution2.54 Å
Binding residue
(original residue number in PDB)
Y7 M45 E63 K66 V67 H70 T73 D77 Y84 R97 Y99 T143 W147 L156 Y159 T163 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 M45 E63 K66 V67 H70 T73 D77 Y84 R97 Y99 T143 W147 L156 Y159 T163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7rk7, PDBe:7rk7, PDBj:7rk7
PDBsum7rk7
PubMed
UniProtP04439|HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain (Gene Name=HLA-A)

[Back to BioLiP]