Structure of PDB 7rjl Chain A Binding Site BS01

Receptor Information
>7rjl Chain A (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMPEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLP
DYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDD
IVLMAQALEKIFLQKVAQMPQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rjl Uncovering the Bromodomain Interactome using Site-Specific Azide-Acetyllysine Photochemistry, Proteomic Profiling and Structural Characterization
Resolution1.5 Å
Binding residue
(original residue number in PDB)		F55 W57 P58 V63 L68 D72 Y115 N116 D121
Binding residue
(residue number reindexed from 1)		F34 W36 P37 V42 L47 D51 Y94 N95 D100
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7rjl, PDBe:7rjl, PDBj:7rjl
PDBsum7rjl
PubMed
UniProtQ15059|BRD3_HUMAN Bromodomain-containing protein 3 (Gene Name=BRD3)

[Back to BioLiP]