Structure of PDB 7rjk Chain A Binding Site BS01

Receptor Information
>7rjk Chain A (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDY
HKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIV
LMAQALEKIFLQKVAQMPQEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rjk Uncovering the Bromodomain Interactome using Site-Specific Azide-Acetyllysine Photochemistry, Proteomic Profiling and Structural Characterization
Resolution1.85 Å
Binding residue
(original residue number in PDB)		V63 L70 P71 D72 Y115 N116 K117 D121 I122 M125
Binding residue
(residue number reindexed from 1)		V40 L47 P48 D49 Y92 N93 K94 D98 I99 M102
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7rjk, PDBe:7rjk, PDBj:7rjk
PDBsum7rjk
PubMed
UniProtQ15059|BRD3_HUMAN Bromodomain-containing protein 3 (Gene Name=BRD3)

[Back to BioLiP]