Structure of PDB 7rh2 Chain A Binding Site BS01

Receptor Information
>7rh2 Chain A (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGRQDYNREEDAALF
KAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDP
YKVYRIVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rh2 The molecular basis for the development of adult T-cell leukemia/lymphoma in patients with an IRF4 K59R mutation.
Resolution2.47 Å
Binding residue
(original residue number in PDB)		W54 H56 A57 Y62 K94 R98 K103
Binding residue
(residue number reindexed from 1)		W33 H35 A36 Y41 K73 R77 K82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7rh2, PDBe:7rh2, PDBj:7rh2
PDBsum7rh2
PubMed34913532
UniProtQ15306|IRF4_HUMAN Interferon regulatory factor 4 (Gene Name=IRF4)

[Back to BioLiP]