Structure of PDB 7rgu Chain A Binding Site BS01

Receptor Information
>7rgu Chain A (length=111) Species: 446 (Legionella pneumophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKAQKNQSKRARSDALLWLAANFPEAFDNSLRIRPLKIGIMSDILQHAEK
AEQVGVSKSKLREAVVLFTRRLDYLACLKAREVRIDLHGNPVAEVTEEEA
ENASMKIKKRV
Ligand information
>7rgu Chain B (length=28) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugggucaaucuucggauuggcccuuucu
.<<<<<<<<<....>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rgu Structural basis for recognition of transcriptional terminator structures by ProQ/FinO domain RNA chaperones.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		S21 I51 G52 I53 M54 S70 K71 S72 K73 R75 V79 T82 Y87 R97 E112 K119
Binding residue
(residue number reindexed from 1)		S8 I38 G39 I40 M41 S57 K58 S59 K60 R62 V66 T69 Y74 R84 E99 K106
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0033592 RNA strand annealing activity
GO:0034057 RNA strand-exchange activity
Biological Process
GO:0010608 post-transcriptional regulation of gene expression

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7rgu, PDBe:7rgu, PDBj:7rgu
PDBsum7rgu
PubMed36400772
UniProtA0A3A6VMJ3

[Back to BioLiP]