Structure of PDB 7rdv Chain A Binding Site BS01

Receptor Information

>7rdv Chain A (length=181) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEFGQ
LILFEPQGGLQNIAAEKHNLGILTKRSNFTPATNEAPQATVFPKSPVLLG
QPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFLVNRDHSFHKLSY
LTFIPSDDDIYDCKVEHWGLEEPVLKHWTSG

Ligand information

>7rdv Chain H (length=12) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EGRVRVNSAYQS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7rdv TFH TCR bound to MHC Class II IAd presenting aggrecan epitope
Resolution	2.90007 Å
Binding residue (original residue number in PDB)	Y8 H24 I52 F54 G58 Q61 N62 A65 N69 I72 R76
Binding residue (residue number reindexed from 1)	Y8 H24 I52 F54 G58 Q61 N62 A65 N69 I72 R76

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7rdv, PDBe:7rdv, PDBj:7rdv
PDBsum	7rdv
PubMed
UniProt	P04228\|HA2D_MOUSE H-2 class II histocompatibility antigen, A-D alpha chain (Gene Name=H2-Aa)

[Back to BioLiP]