Structure of PDB 7rce Chain A Binding Site BS01

Receptor Information

>7rce Chain A (length=285) Species: 32630 (synthetic construct)

RRESINPWILTGFADAEGSFGLSILNRARYHTRLSFTIMLHNKDKSILEN
IQSTWKVGSILNNGDHYVSLVVYRFEDLKVIIDHFEKYPLITQKLGDYKL
FKQAFSVMENKEHLKENGIKELVRIKAKMNWGLNDELKKAFPENISKERP
LINKNIPNFKWLAGFTSGDGSFFVRLRVRVQLVFEISQHIRDKNLMNSLI
TYLGCGHIYEGNKSERSWLQFRVEKFSDINDKIIPVFQENTLIGVKLEDF
EDWCKVAKLIEEKKHLTESGLDEIKKIKLNMNKGR

Ligand information

>7rce Chain B (length=26)

gggggcatgcagatcccacaggcgcg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7rce Characterization of the stepwise engineering and optimization of a retargeted DNA binding protein and gene-editing meganuclease
• Resolution: 2.42 Å
• Binding residue (original residue number in PDB): R42 Y82 F84 H122 W140 G177 D178 S180 F182 R184 R186 E201 S203 Q204 H205 S233 W234 Q236 N298
• Binding residue (residue number reindexed from 1): R33 Y73 F75 H113 W131 G168 D169 S171 F173 R175 R177 E185 S187 Q188 H189 S217 W218 Q220 N282

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 23 04:41:44 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7rce', asym_id = 'A', bs = 'BS01', title = 'Characterization of the stepwise engineering and...DNA binding protein and gene-editing meganuclease'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7rce', asym_id='A', bs='BS01', title='Characterization of the stepwise engineering and...DNA binding protein and gene-editing meganuclease')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0004519', uniprot = '', pdbid = '7rce', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519', uniprot='', pdbid='7rce', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>