Structure of PDB 7r8w Chain A Binding Site BS01

Receptor Information
>7r8w Chain A (length=113) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QKTDHFLSCYPWFHGPISRVRAAQLVQLQGPDAHGVFLVRQSESRRGEYV
LTFNLQGRAKHLRLVLTERGQCRVQHLHFPSVVDMLRHFQRSPIPLECGA
ACDVRLSGYVVVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r8w Structural and functional analysis of target recognition by the lymphocyte adaptor protein LNK.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R343 R364 S366 E367 S368 V374 K384 H385 R387 Q399 H400 P419 L420 E421
Binding residue
(residue number reindexed from 1)		R19 R40 S42 E43 S44 V50 K60 H61 R63 Q75 H76 P95 L96 E97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0035591 signaling adaptor activity
Biological Process
GO:0007165 signal transduction

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7r8w, PDBe:7r8w, PDBj:7r8w
PDBsum7r8w
PubMed34671038
UniProtO09039|SH2B3_MOUSE SH2B adapter protein 3 (Gene Name=Sh2b3)

[Back to BioLiP]