Structure of PDB 7r7v Chain A Binding Site BS01

Receptor Information
>7r7v Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAP
WIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHIIQRMYG
CDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r7v Molecular basis of differential HLA class I-restricted T cell recognition of a highly networked HIV peptide.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		Y7 Y59 R62 N63 F67 N77 I80 Y84 I95 R97 Y99 D114 Y123 T143 K146 W147 Q155 Y159 L163 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 Y59 R62 N63 F67 N77 I80 Y84 I95 R97 Y99 D114 Y123 T143 K146 W147 Q155 Y159 L163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links