Structure of PDB 7r6r Chain A Binding Site BS01

Receptor Information
>7r6r Chain A (length=167) Species: 2041553 (Mycobacterium phage TipsytheTRex) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRIPLTLSEIEDLRRKGFNQTEIAELYGVTRQAVSWHKKTYGGRLTTRQI
VQQNWPWDTRKPHDKSKAFQRLRDHGEYMRVGSFRTMSEDKKKRLLSWWK
MLRDNDLVLEFDPSIEPYEGMAGGGFRYVPRDISDDDLLIRVNEHTQLTA
EGELLWSWPDDIEELLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r6r A monomeric mycobacteriophage immunity repressor utilizes two domains to recognize an asymmetric DNA sequence.
Resolution3.13 Å
Binding residue
(original residue number in PDB)		N33 Q34 T35 R45 Q46 S49 K52 K53 Q63 K79 K81 R108 S111 G134 A136
Binding residue
(residue number reindexed from 1)		N19 Q20 T21 R31 Q32 S35 K38 K39 Q49 K65 K67 R94 S97 G120 A122
Enzymatic activity
Enzyme Commision number ?
External links