Structure of PDB 7qxb Chain A Binding Site BS01

Receptor Information
>7qxb Chain A (length=951) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLV
CVPWDARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLPE
AFTTSVRSYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVA
PSCAYQVCGPPLYQLGPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLT
GARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPY
GVLLKTHCPLRADPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSR
HNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPA
AEHRLREEILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVW
SKLQSIGIRQHLKRVQLRELSEAEVRQHREARPALLTSRLRFIPKPDGLR
PIVNMDYVVGARTFRREKRAERLTSRVKALFSVLNYERARRPGLLGASVL
GLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVIAS
IIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHLQ
ETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGI
PQGSILSTLLCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAK
TFLRTLVRGVPEYGCVVNLRKTVVNFPVEDEALGGTAFVQMPAHGLFPWC
GLLLDTRTLEVQSDYSSYARTSIRASLTFNRGFKAGRNMRRKLFGVLRLK
CHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLPFHQQVWKNPTF
FLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLLK
LTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTIL
D
Ligand information
>7qxb Chain B (length=256) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggugguggccauuuuuugucuaacccuaacugagaagggcguaggcgcc
gugcuuuugcuccccgcgcgcuguuuuucucgcugacuuucagcgggcgg
aaaagccucggccugccgccuuccgagcaaacaaaaaaugucagcugcug
gcccguucgccccgaaccccgccgaggccgcggucggcccggggcuucuc
cggaggcacccacugccaccgcgaagaguugggcucugucagccgcgggu
cucucg
...<.<.<<<<..........................<<<<<<<<<<...
..<<<<<<.....<<<<.<<<<<.......[(((((((((>>>>>.>>>>
>>>>>>....>>>>>>.>>>>..............))).)))))).]..>
>>>>....>...<<<..<<<<<....<..<<<<<.<<<..<<<<<<....
....>>>.>>>...>>>>>>>>..<<<<.....>>>>.....>.>>>>>.
...>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qxb Structural basis of human telomerase recruitment by TPP1-POT1.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		R15 K338 R342 P343 R351 S353 L354 T355 W371 T375 R377 R378 R381 L382 Q384 R385 W387 R390 P404 V407 Y462 R466 R470 R471 R481 H482 R489 Q506 W510 K511 M512 S513 V514 R515 R522 V529 P530 A531 H534 R535 E538 R558 R620 R622 I633 N635 D637 Q748 K749 A751 R787 R819 G834 S835 I836 T839 F964 K965 G967 R968 R979 F1021 Q1023 K1027 F1031 G1057 A1058 K1059 S1067 V1087 G1094
Binding residue
(residue number reindexed from 1)		R9 K183 R187 P188 R196 S198 L199 T200 W216 T220 R222 R223 R226 L227 Q229 R230 W232 R235 P249 V252 Y281 R285 R289 R290 R300 H301 R308 Q325 W329 K330 M331 S332 V333 R334 R341 V348 P349 A350 H353 R354 E357 R377 R439 R441 I452 N454 D456 Q567 K568 A570 R606 R638 G653 S654 I655 T658 F783 K784 G786 R787 R798 F840 Q842 K846 F850 G876 A877 K878 S886 V906 G913
Enzymatic activity
Enzyme Commision number 2.7.7.49: RNA-directed DNA polymerase.
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0001223 transcription coactivator binding
GO:0003677 DNA binding
GO:0003720 telomerase activity
GO:0003723 RNA binding
GO:0003964 RNA-directed DNA polymerase activity
GO:0003968 RNA-dependent RNA polymerase activity
GO:0005515 protein binding
GO:0042162 telomeric DNA binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0051087 protein-folding chaperone binding
GO:0070034 telomerase RNA binding
GO:0098680 template-free RNA nucleotidyltransferase
Biological Process
GO:0000723 telomere maintenance
GO:0001172 RNA-templated transcription
GO:0006278 RNA-templated DNA biosynthetic process
GO:0007004 telomere maintenance via telomerase
GO:0007005 mitochondrion organization
GO:0010629 negative regulation of gene expression
GO:0022616 DNA strand elongation
GO:0030177 positive regulation of Wnt signaling pathway
GO:0030422 siRNA processing
GO:0031647 regulation of protein stability
GO:0032092 positive regulation of protein binding
GO:0042635 positive regulation of hair cycle
GO:0043066 negative regulation of apoptotic process
GO:0043524 negative regulation of neuron apoptotic process
GO:0045766 positive regulation of angiogenesis
GO:0046326 positive regulation of D-glucose import
GO:0046686 response to cadmium ion
GO:0051000 positive regulation of nitric-oxide synthase activity
GO:0070200 establishment of protein localization to telomere
GO:0071456 cellular response to hypoxia
GO:0071897 DNA biosynthetic process
GO:0090399 replicative senescence
GO:0140745 siRNA transcription
GO:1900087 positive regulation of G1/S transition of mitotic cell cycle
GO:1902895 positive regulation of miRNA transcription
GO:1903620 positive regulation of transdifferentiation
GO:1904707 positive regulation of vascular associated smooth muscle cell proliferation
GO:1904751 positive regulation of protein localization to nucleolus
GO:1904754 positive regulation of vascular associated smooth muscle cell migration
GO:2000352 negative regulation of endothelial cell apoptotic process
GO:2000648 positive regulation of stem cell proliferation
GO:2000773 negative regulation of cellular senescence
GO:2001240 negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
Cellular Component
GO:0000333 telomerase catalytic core complex
GO:0000781 chromosome, telomeric region
GO:0000783 nuclear telomere cap complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005697 telomerase holoenzyme complex
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016605 PML body
GO:0016607 nuclear speck
GO:0031379 RNA-directed RNA polymerase complex
GO:0042645 mitochondrial nucleoid
GO:0043231 intracellular membrane-bounded organelle
GO:1990572 TERT-RMRP complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qxb, PDBe:7qxb, PDBj:7qxb
PDBsum7qxb
PubMed35201900
UniProtO14746|TERT_HUMAN Telomerase reverse transcriptase (Gene Name=TERT)

[Back to BioLiP]