Structure of PDB 7qwv Chain A Binding Site BS01

Receptor Information
>7qwv Chain A (length=117) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMGEVSQWSLKRYGRFMLLGSPTWKVFESSEESGSLVLTIVVSGHFFISQ
GQTLLEGFSLIGSKNWLKIVRRMDCLLFGTTSRMFRVQFSGESKEEALER
CCGCVQTLAQYVTVQEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qwv TOPOVIBL-REC114 interaction regulates meiotic DNA double-strand breaks.
Resolution2.26 Å
Binding residue
(original residue number in PDB)
R24 W51 K95 R99 C102 L104 G106 M115 R117 K125
Binding residue
(residue number reindexed from 1)
R12 W24 K68 R72 C75 L77 G79 M84 R86 K94
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7qwv, PDBe:7qwv, PDBj:7qwv
PDBsum7qwv
PubMed36396648
UniProtQ9CWH4|RE114_MOUSE Meiotic recombination protein REC114 (Gene Name=Rec114)

[Back to BioLiP]