Structure of PDB 7qtw Chain A Binding Site BS01

Receptor Information
>7qtw Chain A (length=146) Species: 37296 (Human gammaherpesvirus 8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLSPIKLYITGLMRDKESL
FEAMLANVRFHSTTGINQLGLSMLQVSGDGNMNWGRALAILTFGSFVAQK
LSNEPHLRDFALAVLPAYAYEAIGPQWFRARGGWRGLKAYCTQVLT
Ligand information
>7qtw Chain B (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ESQEDIIRNIARHLAQVGDSMDRSIPPG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qtw Structural Insight into KsBcl-2 Mediated Apoptosis Inhibition by Kaposi Sarcoma Associated Herpes Virus.
Resolution1.41 Å
Binding residue
(original residue number in PDB)		M54 Q68 L71 S72 Q75 V76 N83 W84 G85 R86 F93 Y140 T146
Binding residue
(residue number reindexed from 1)		M54 Q68 L71 S72 Q75 V76 N83 W84 G85 R86 F93 Y140 T146
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:7qtw, PDBe:7qtw, PDBj:7qtw
PDBsum7qtw
PubMed35458468
UniProtQ76RI8

[Back to BioLiP]